PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA28409
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family CO-like
Protein Properties Length: 413aa    MW: 45324.1 Da    PI: 4.7024
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA28409genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.44.6e-06444539
                   zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                               +C+ +++++   +C+++  +lC +C  + H+       H++
  Tp57577_TGAC_v2_mRNA28409  4 ICDFCGDQRSMVYCRSDAACLCLSCDRNVHSAntlarrHSR 44
                               7*****************************65667767765 PP

2zf-B_box22.22.9e-074689441
                   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                                 C++++++++   C + +  lC++C   +H +      H++++
  Tp57577_TGAC_v2_mRNA28409 46 LLCERCSSQPALVRCSEEKISLCQNCDWLGHGNnstssnHKRQT 89
                               57*****************************5578999999876 PP

3CCT60.74.9e-21355398144
                        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                R  a++RYkeK+ktRkF+K++rY+sRK++A+ R RvKGrFvk+ 
  Tp57577_TGAC_v2_mRNA28409 355 RCSAVMRYKEKKKTRKFDKRVRYASRKERADVRRRVKGRFVKAG 398
                                6689*************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.741147IPR000315B-box-type zinc finger
SMARTSM003361.3E-8447IPR000315B-box-type zinc finger
CDDcd000217.87E-7447No hitNo description
PROSITE profilePS501199.0864390IPR000315B-box-type zinc finger
CDDcd000210.001084790No hitNo description
SMARTSM003360.344890IPR000315B-box-type zinc finger
PfamPF062037.3E-16355397IPR010402CCT domain
PROSITE profilePS5101715.209355397IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MGYICDFCGD QRSMVYCRSD AACLCLSCDR NVHSANTLAR RHSRTLLCER CSSQPALVRC  60
SEEKISLCQN CDWLGHGNNS TSSNHKRQTI NCYSGCPSSS ELSSIWSFVL DIPSLSETTC  120
EQELGFMSIN ENRSAWVDPK NQNVSDSDKA TDLPDSDKSF VGTSSKPESS KEPRMLDRSD  180
GPTNECVPKL YCPAKNCPDA SEDDDDLYGD FDMDEMDINI ENYDELFGMA LTHSEELFEN  240
GGFNSLFGAK AMSAGDSNCQ DAIAAEGSSI GHVNAAQPAC STAASADSIL STKTEPNLCI  300
TAKPSQSSLS FSGINEDGGG GDYQDCGASS MLLMGEPPWL NTCPENELQL QSANRCSAVM  360
RYKEKKKTRK FDKRVRYASR KERADVRRRV KGRFVKAGEA YDYDPLSQTR SY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1436830.0BT143683.1 Medicago truncatula clone JCVI-FLMt-20N9 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003601522.10.0B-box type zinc finger protein
SwissprotQ9SSE51e-145COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLG7J8U10.0G7J8U1_MEDTR; B-box type zinc finger protein
STRINGGLYMA20G07051.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43623353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.41e-120CONSTANS-like 9